PHF1 Antibody

CAT:
247-OAAL00237-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
PHF1 Antibody - image 1

PHF1 Antibody

  • CAS Number :

    9007-83-4
  • Gene Name :

    PHD finger protein 1
  • Gene Aliases :

    HPCl1; hPHF1; MTF2L2; PCL1; PHD finger protein 1; PHF2; polycomb-like 1; polycomb-like protein 1; TDRD19C; testicular tissue protein Li 140; tudor domain containing 19C.
  • Gene ID :

    5252
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/NP_077084
  • Reactivity :

    Human, Mouse
  • Immunogen :

    PHF1 (NP_077084, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    This gene encodes a Polycomb group protein. The protein is a component of a histone H3 lysine-27 (H3K27) -specific methyltransferase complex, and functions in transcriptional repression of homeotic genes. The protein is also recruited to double-strand breaks, and reduced protein levels results in X-ray sensitivity and increased homologous recombination. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Clonality :

    Monoclonal
  • Clone :

    4D8
  • Type :

    Monoclonal Antibody
  • Sequence :

    AQPPRLSRSGASSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPGEELLCCVCRSETVVP
  • Applications :

    Enzyme-linked immunosorbent assay|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG1 Kappa
  • NCBI Gene Symbol :

    PHF1
  • Host or Source :

    Mouse
  • Protein Name :

    Homo sapiens PHD finger protein 1 (PHF1), transcript variant 2, mRNA|PHD finger protein 1 isoform b [Homo sapiens]
  • Gene Name URL :

    PHF1
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/NM_024165

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide