OPA1 Antibody

• Gene Name:

  OPA1 mitochondrial dynamin like GTPase

• Gene Aliases:

  BERHS; dynamin-like 120 kDa protein, mitochondrial; dynamin-like guanosine triphosphatase; largeG; MGM1; mitochondrial dynamin-like GTPase; MTDPS14; NPG; NTG; optic atrophy 1 (autosomal dominant) ; optic atrophy protein 1.

• Gene ID:

  4976

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/NP_056375

• Reactivity:

  Human, Mouse

• Immunogen:

  OPA1 (NP_056375, 851 a.a. ~ 960 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  This gene product is a nuclear-encoded mitochondrial protein with similarity to dynamin-related GTPases. It is a component of the mitochondrial network. Mutations in this gene have been associated with optic atrophy type 1, which is a dominantly inherited optic neuropathy resulting in progressive loss of visual acuity, leading in many cases to legal blindness. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

• Clonality:

  Monoclonal

• Clone:

  1C10

• Type:

  Monoclonal Antibody

• Sequence:

  NHCNLCRRGFYYYQRHFVDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVLEDFAEDGEKKIKLLTGKRVQLAEDLKKVREIQEKLDAFIEALHQEK

• Applications:

  Enzyme-linked immunosorbent assay

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG1 Kappa

• NCBI Gene Symbol:

  OPA1

• Host or Source:

  Mouse

• Protein Name:

  Dynamin-like 120 kDa protein, mitochondrial isoform 1 preproprotein [Homo sapiens]|Homo sapiens OPA1, mitochondrial dynamin like GTPase (OPA1), transcript variant 1, mRNA

• Gene Name URL:

  OPA1

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/NM_015560