MEF2B Antibody

• Gene Name :

  BORCS8-MEF2B readthrough

• Gene Aliases :

  LOC729991-MEF2B; LOC729991-MEF2B readthrough; MEF2B; MEF2BNB-MEF2B; MEF2BNB-MEF2B readthrough; myocyte enhancer factor 2B; myocyte-specific enhancer factor 2B; RSRFR2; serum response factor-like protein 2.

• Gene ID :

  4207

• Accession Number :

  https://www.ncbi.nlm.nih.gov/protein/NP_005910.1

• Reactivity :

  Human, Mouse

• Immunogen :

  MEF2B (NP_005910.1, 165 a.a. ~ 235 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target :

  This gene represents numerous read-through transcripts that span geneID:729991 and 100271849. Many read-through transcripts are predicted to be nonsense-mediated decay (NMD) candidates, and are thought to be non-coding. Some transcripts are predicted to be capable of translation reinitation at a downstream AUG, resulting in expression of at least one isoform of myocyte enhancer factor 2B (MEF2B) from this read-through locus. At least one additional MEF2B variant and isoform can be expressed from a downstream promoter, and is annotated on geneID:100271849. [provided by RefSeq

• Clonality :

  Monoclonal

• Clone :

  4B5

• Type :

  Monoclonal Antibody

• Sequence :

  SRPSPFRPAAPKAGPPGLVHPLFSPSHLTSKTPPPLYLPTEGRRSDLPGGLAGPRGGLNTSRSLYSGLQNP

• Applications :

  Enzyme-linked immunosorbent assay|Western blot

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format :

  Liquid

• Reconstitution :

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment :

  IgG2a Kappa

• NCBI Gene Symbol :

  BORCS8-MEF2B

• Host or Source :

  Mouse

• Protein Name :

  Homo sapiens BORCS8-MEF2B readthrough (BORCS8-MEF2B), transcript variant 1, mRNA|myocyte enhancer factor 2B isoform b [Homo sapiens]

• Gene Name URL :

  BORCS8-MEF2B

• CAS Number :

  9007-83-4

• Nucleotide Accession Number :

  https://www.ncbi.nlm.nih.gov/nuccore/NM_005919