FRZB Antibody
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


FRZB Antibody
Gene Name :
Frizzled related proteinGene Aliases :
FRE; frezzled; FRITZ; frizzled homolog-related; frizzled-related protein 1; FRP-3; FRZB1; FRZB-1; FRZB-PEN; FZRB; hFIZ; OS1; secreted frizzled-related protein 3; sFRP-3; SFRP3; SRFP3.Gene ID :
2487Accession Number :
https://www.ncbi.nlm.nih.gov/protein/NP_001454Reactivity :
Human, MouseImmunogen :
FRZB (NP_001454, 102 a.a. ~ 190 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.Clonality :
MonoclonalClone :
4B8Type :
Monoclonal AntibodySequence :
HEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTY*Applications :
Enzyme-linked immunosorbent assay|Western blotAssay Protocol :
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) ProtocolFormat :
LiquidReconstitution :
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.Fragment :
IgG2a KappaNCBI Gene Symbol :
FRZBHost or Source :
MouseProtein Name :
Homo sapiens frizzled related protein (FRZB), mRNA|secreted frizzled-related protein 3 precursor [Homo sapiens]Gene Name URL :
FRZBCAS Number :
9007-83-4Nucleotide Accession Number :
https://www.ncbi.nlm.nih.gov/nuccore/NM_001463

