ABCC6 Antibody

• Gene Name:

  ATP binding cassette subfamily C member 6

• Gene Aliases:

  ABC34; anthracycline resistance-associated protein; ARA; ATP-binding cassette sub-family C member 6; ATP-binding cassette, sub-family C (CFTR/MRP), member 6; EST349056; GACI2; MLP1; MOATE; MOAT-E; MRP6; multidrug resistance-associated protein 6; multi-specific organic anion transporter E; PXE; PXE1; URG7; URG7 protein.

• Gene ID:

  368

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/NP_001162

• Reactivity:

  Human, Mouse

• Immunogen:

  ABCC6 (NP_001162, 831 a.a. ~ 930 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White) . The encoded protein, a member of the MRP subfamily, is involved in multi-drug resistance. Mutations in this gene cause pseudoxanthoma elasticum. Alternatively spliced transcript variants that encode different proteins have been described for this gene. [provided by RefSeq

• Clonality:

  Monoclonal

• Clone:

  1000000

• Type:

  Monoclonal Antibody

• Sequence:

  IAEMGSYQELLQRKGALVCLLDQARQPGDRGEGETEPGTSTKDPRGTSAGRRPELRRERSIKSVPEKDRTTSEAQTEVPLDDPDRAGWPAGKDSIQYGRV

• Applications:

  Enzyme-linked immunosorbent assay|Western blot

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG2b Kappa

• NCBI Gene Symbol:

  ABCC6

• Host or Source:

  Mouse

• Protein Name:

  Homo sapiens ATP binding cassette subfamily C member 6 (ABCC6), transcript variant 1, mRNA|multidrug resistance-associated protein 6 isoform 1 [Homo sapiens]

• Gene Name URL:

  ABCC6

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/NM_001171