ABCC6 Antibody

CAT:
247-OAAL00013-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
ABCC6 Antibody - image 1

ABCC6 Antibody

  • Gene Name:

    ATP binding cassette subfamily C member 6
  • Gene Aliases:

    ABC34; anthracycline resistance-associated protein; ARA; ATP-binding cassette sub-family C member 6; ATP-binding cassette, sub-family C (CFTR/MRP), member 6; EST349056; GACI2; MLP1; MOATE; MOAT-E; MRP6; multidrug resistance-associated protein 6; multi-specific organic anion transporter E; PXE; PXE1; URG7; URG7 protein.
  • Gene ID:

    368
  • Accession Number:

    https://www.ncbi.nlm.nih.gov/protein/NP_001162
  • Reactivity:

    Human, Mouse
  • Immunogen:

    ABCC6 (NP_001162, 831 a.a. ~ 930 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target:

    The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White) . The encoded protein, a member of the MRP subfamily, is involved in multi-drug resistance. Mutations in this gene cause pseudoxanthoma elasticum. Alternatively spliced transcript variants that encode different proteins have been described for this gene. [provided by RefSeq
  • Clonality:

    Monoclonal
  • Clone:

    1000000
  • Type:

    Monoclonal Antibody
  • Sequence:

    IAEMGSYQELLQRKGALVCLLDQARQPGDRGEGETEPGTSTKDPRGTSAGRRPELRRERSIKSVPEKDRTTSEAQTEVPLDDPDRAGWPAGKDSIQYGRV
  • Applications:

    Enzyme-linked immunosorbent assay|Western blot
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format:

    Liquid
  • Reconstitution:

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment:

    IgG2b Kappa
  • NCBI Gene Symbol:

    ABCC6
  • Host or Source:

    Mouse
  • Protein Name:

    Homo sapiens ATP binding cassette subfamily C member 6 (ABCC6), transcript variant 1, mRNA|multidrug resistance-associated protein 6 isoform 1 [Homo sapiens]
  • Gene Name URL:

    ABCC6
  • CAS Number:

    9007-83-4
  • Nucleotide Accession Number:

    https://www.ncbi.nlm.nih.gov/nuccore/NM_001171