Products for Research Use Only

BCL6 Antibody

CAT: 0247-OAAF08170-100UGSize: 100 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0247-OAAF08170-100UGSize:100 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
CAS Number
9007-83-4
Gene Name
BCL6 transcription repressor
Gene Aliases
B cell CLL/lymphoma 6; B-cell lymphoma 5 protein; B-cell lymphoma 6 protein; B-cell lymphoma 6 protein transcript; BCL5; BCL-5; BCL-6; BCL6A; cys-his2 zinc finger transcription factor; LAZ3; lymphoma-associated zinc finger gene on chromosome 3; protein LAZ-3; ZBTB27; zinc finger and BTB domain-containing protein 27; zinc finger protein 51; zinc finger transcription factor BCL6S; ZNF51.
Gene ID
604
Swiss Prot
P41182
Reactivity
Human|Mouse|Rat
Immunogen
The antiserum was produced against synthesized peptide derived from the Internal region of human BCL6.
Target
Transcriptional repressor mainly required for germinal center (GC) formation and antibody affinity maturation which has different mechanisms of action specific to the lineage and biological functions. Forms complexes with different corepressors and histone deacetylases to repress the transcriptional expression of different subsets of target genes. Represses its target genes by binding directly to the DNA sequence 5'-TTCCTAGAA-3' (BCL6-binding site) or indirectly by repressing the transcriptional activity of transcription factors. In GC B-cells, represses genes that function in differentiation, inflammation, apoptosis and cell cycle control, also autoregulates its transcriptional expression and up-regulates, indirectly, the expression of some genes important for GC reactions, such as AICDA, through the repression of microRNAs expression, like miR155. An important function is to allow GC B-cells to proliferate very rapidly in response to T-cell dependent antigens and tolerate the physiological DNA breaks required for immunglobulin class switch recombination and somatic hypermutation without inducing a p53/TP53-dependent apoptotic response. In follicular helper CD4 (+) T-cells (T (FH) cells), promotes the expression of T (FH) -related genes but inhibits the differentiation of T (H) 1, T (H) 2 and T (H) 17 cells. Also required for the establishment and maintenance of immunological memory for both T- and B-cells. Suppresses macrophage proliferation through competition with STAT5 for STAT-binding motifs binding on certain target genes, such as CCL2 and CCND2. In response to genotoxic stress, controls cell cycle arrest in GC B-cells in both p53/TP53-dependedent and -independent manners. Besides, also controls neurogenesis through the alteration of the composition of NOTCH-dependent transcriptional complexes at selective NOTCH targets, such as HES5, including the recruitment of the deacetylase SIRT1 and resulting in an epigenetic silencing leading to neuronal differentiation.
Clonality
Polyclonal
Type
Polyclonal Antibody
Sequence
SDMHYSVAEGLKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPN
Applications
Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot
Purification
The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
Concentration
1mg/ml
Format
Liquid// PBS (without Mg2+ and Ca2+) (pH 7.4), 150mM NaCl, 0.02% sodium azide and 50% glycerol2+2+
Reconstitution
-20°C
Molecular Weight
78 kDa
Fragment
IgG
Specificity
BCL6 Antibody detects endogenous levels of BCL6 protein.
NCBI Gene Symbol
BCL6
Host or Source
Rabbit
Protein Name
B-cell lymphoma 6 protein
Gene Name URL
BCL6