DUSP3 Antibody

• Gene Name :

  Dual specificity phosphatase 3

• Gene Aliases :

  Dual specificity protein phosphatase 3; dual specificity protein phosphatase VHR; serine/threonine specific protein phosphatase; vaccinia H1-related phosphatase; vaccinia virus phosphatase VH1-related; VHR.

• Gene ID :

  1845

• Swiss Prot :

  P51452

• Reactivity :

  Human|Mouse|Rat

• Immunogen :

  The antiserum was produced against synthesized peptide derived from the C-terminal region of human DUSP3.

• Target :

  Shows activity both for tyrosine-protein phosphate and serine-protein phosphate, but displays a strong preference toward phosphotyrosines. Specifically dephosphorylates and inactivates ERK1 and ERK2.

• Clonality :

  Polyclonal

• Type :

  Polyclonal Antibody

• Sequence :

  IAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP

• Applications :

  Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot

• Purification :

  The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration :

  1mg/ml

• Reconstitution :

  -20°C

• Molecular Weight :

  20 kDa

• Specificity :

  DUSP3 Antibody detects endogenous levels of DUSP3 protein.

• NCBI Gene Symbol :

  DUSP3

• Host or Source :

  Rabbit

• Protein Name :

  Dual specificity protein phosphatase 3

• Gene Name URL :

  DUSP3

• CAS Number :

  9007-83-4