HDAC8 Antibody

CAT:
247-OAAF07886-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
HDAC8 Antibody - image 1

HDAC8 Antibody

  • CAS Number :

    9007-83-4
  • Gene Name :

    Histone deacetylase 8
  • Gene Aliases :

    CDA07; CDLS5; HD8; HDACL1; histone deacetylase 8; histone deacetylase-like 1; KDAC8; MRXS6; RPD3; WTS.
  • Gene ID :

    55869
  • Swiss Prot :

    Q9BY41
  • Reactivity :

    Human|Monkey|Mouse|Rat
  • Immunogen :

    The antiserum was produced against synthesized peptide derived from human HDAC8.
  • Target :

    Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4) . Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Also involved in the deacetylation of cohesin complex protein SMC3 regulating release of cohesin complexes from chromatin. May play a role in smooth muscle cell contractility.
  • Clonality :

    Polyclonal
  • Type :

    Polyclonal Antibody
  • Sequence :

    EEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQM
  • Applications :

    Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
  • Purification :

    The antibody was purified from rabbit antiserum by affinity-chromatography using immunogen.
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Concentration :

    1mg/ml
  • Reconstitution :

    -20°C
  • Molecular Weight :

    41 kDa
  • Notes :

    Formerly GWB-ASC706
  • Specificity :

    HDAC8 Antibody detects endogenous levels of total HDAC8 protein.
  • NCBI Gene Symbol :

    HDAC8
  • Host or Source :

    Rabbit
  • Protein Name :

    Histone deacetylase 8
  • Gene Name URL :

    HDAC8

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide