STAT5A Antibody (Phospho-Ser780)

• Gene Name:

  Signal transducer and activator of transcription 5A

• Gene Aliases:

  Epididymis secretory sperm binding protein; MGF; signal transducer and activator of transcription 5A; STAT5.

• Gene ID:

  6776

• Swiss Prot:

  P42229

• Reactivity:

  Human|Mouse|Rat

• Immunogen:

  The antiserum was produced against synthesized peptide derived from human STAT5A around the phosphorylation site of Ser780.

• Target:

  Carries out a dual function: signal transduction and activation of transcription. Mediates cellular responses to the cytokine KITLG/SCF and other growth factors. Mediates cellular responses to ERBB4. May mediate cellular responses to activated FGFR1, FGFR2, FGFR3 and FGFR4. Binds to the GAS element and activates PRL-induced transcription. Regulates the expression of milk proteins during lactation.

• Clonality:

  Polyclonal

• Type:

  Polyclonal Antibody

• Sequence:

  VLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLSPPAGLFTSARGSLS

• Applications:

  Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin|Immunoprecipitation|Western blot

• Purification:

  The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration:

  1mg/ml

• Reconstitution:

  -20°C

• Molecular Weight:

  90 kDa

• Notes:

  Formerly GWB-ASB812

• Specificity:

  STAT5A (Phospho-Ser780) Antibody detects endogenous levels of STAT5A only when phosphorylated at Ser780.

• NCBI Gene Symbol:

  STAT5A

• Host or Source:

  Rabbit

• Protein Name:

  Signal transducer and activator of transcription 5A

• Gene Name URL:

  STAT5A

• CAS Number:

  9007-83-4