Inositol 1, 4, 5-trisphosphate R1 Antibody (Phospho-Ser1598/1588)

• Description:

  Click here to learn more about Aviva's By-Request Conjugation Service.//here

• Gene Name:

  Inositol 1,4,5-trisphosphate receptor type 1

• Gene Aliases:

  ACV; CLA4; inositol 1,4,5-triphosphate receptor, type 1; inositol 1,4,5-trisphosphate receptor type 1; INSP3R1; IP3 receptor; IP3 receptor isoform 1; IP3R; IP3R 1; IP3R1; PPP1R94; protein phosphatase 1, regulatory subunit 94; SCA15; SCA16; SCA29; type 1 inositol 1,4,5-trisphosphate receptor; type 1 InsP3 receptor.

• Gene ID:

  3708

• Swiss Prot:

  Q14643

• Reactivity:

  Human|Mouse|Rat

• Immunogen:

  The antiserum was produced against synthesized peptide derived from human Inositol 1,4,5-trisphosphate R1 around the phosphorylation site of Ser1598/1588.

• Target:

  Intracellular channel that mediates calcium release from the endoplasmic reticulum following stimulation by inositol 1,4,5-trisphosphate (PubMed:27108797) . Involved in the regulation of epithelial secretion of electrolytes and fluid through the interaction with AHCYL1 (By similarity) . Plays a role in ER stress-induced apoptosis. Cytoplasmic calcium released from the ER triggers apoptosis by the activation of CaM kinase II, eventually leading to the activation of downstream apoptosis pathways (By similarity) .

• Clonality:

  Polyclonal

• Type:

  Polyclonal Antibody

• Sequence:

  SQVNNLFLKSHSIVQKTAMNWRLSARNAARRDSVLAASRDYRNIIERLQD

• Applications:

  Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry-Paraffin

• Purification:

  The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration:

  1mg/ml

• Reconstitution:

  -20°C

• Molecular Weight:

  313 kDa

• Notes:

  Formerly GWB-ASB502

• Specificity:

  Inositol 1,4,5-trisphosphate R1 (Phospho-Ser1598/1588) Antibody detects endogenous levels of Inositol 1,4,5-trisphosphate R1 only when phosphorylated at Ser1598/1588.

• NCBI Gene Symbol:

  ITPR1

• Host or Source:

  Rabbit

• Protein Name:

  Inositol 1,4,5-trisphosphate receptor type 1

• Gene Name URL:

  ITPR1

• CAS Number:

  9007-83-4