Anti-IL33

• Gene Name:

  DVS27, IL1F11, NF-HEV, NFEHEV, C9orf26

• Gene Aliases:

  DVS27, IL1F11, NF-HEV, NFEHEV, C9orf26

• Gene ID:

  90865

• Swiss Prot:

  O95760

• Accession Number:

  NP_001186569.1

• Reactivity:

  Human

• Immunogen:

  The immunogen is a synthetic peptide directed towards the middle region of human IL33

• Target:

  The protein encoded by this gene is a cytokine that binds to the IL1RL1/ST2 receptor. The encoded protein is involved in the maturation of Th2 cells and the activation of mast cells, basophils, eosinophils and natural killer cells. Several transcript variants encoding different isoforms have been found for this gene.

• Clonality:

  Polyclonal

• Type:

  Polyclonal Antibody

• Sequence:

  YFRRETTKRPSLKTGRKHKRHLVLAACQQQSTVECFAFGISGVQKYTRAL

• Applications:

  WB

• Purification:

  Affinity purified

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration:

  0.5 mg/ml

• Format:

  Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

• Reconstitution:

  For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

• Molecular Weight:

  31 kDa

• Protein Length:

  270

• NCBI Gene Symbol:

  IL33

• Host or Source:

  Rabbit

• Protein Name:

  The protein encoded by this gene is a cytokine that binds to the IL1RL1/ST2 receptor. The encoded protein is involved in the maturation of Th2 cells and the activation of mast cells, basophils, eosinophils and natural killer cells. Several transcript variants encoding different isoforms have been found for this gene.

• Gene Name URL:

  IL33

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  NM_001199640.1