Anti-UNKL

• Gene Name :

  ZC3H5L, C16orf28, ZC3HDC5L

• Gene Aliases :

  ZC3H5L, C16orf28, ZC3HDC5L

• Gene ID :

  64718

• Swiss Prot :

  Q9C0B0

• Accession Number :

  NP_001073888.2

• Reactivity :

  Human

• Immunogen :

  The immunogen is a synthetic peptide directed towards the N terminal region of human UNKL

• Target :

  This gene encodes a RING finger protein that may function in Rac signaling. It can bind to Brg/Brm-associated factor 60b and can promote its ubiquitination. Alternative splicing of this gene results in multiple transcript variants.

• Clonality :

  Polyclonal

• Type :

  Polyclonal Antibody

• Sequence :

  SEEPRWQETAYVLGNYKTEPCKKPPRLCRQGYACPYYHNSKDRRRSPRKH

• Applications :

  WB

• Purification :

  Affinity purified

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration :

  0.5 mg/ml

• Format :

  Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

• Reconstitution :

  For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

• Molecular Weight :

  89 kDa

• Protein Length :

  810

• NCBI Gene Symbol :

  UNKL

• Host or Source :

  Rabbit

• Protein Name :

  This gene encodes a RING finger protein that may function in Rac signaling. It can bind to Brg/Brm-associated factor 60b and can promote its ubiquitination. Alternative splicing of this gene results in multiple transcript variants.

• Gene Name URL :

  UNKL

• CAS Number :

  9007-83-4