BCAS1 Antibody - middle region

CAT:
247-ARP76771_P050-25UL
Size:
25 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
BCAS1 Antibody - middle region - image 1

BCAS1 Antibody - middle region

  • Gene Name:

    Breast carcinoma amplified sequence 1
  • Gene Aliases:

    AIBC1, NABC1, PMES-2
  • Gene ID:

    8537
  • Swiss Prot:

    O75363
  • Accession Number:

    NP_003648.2
  • Reactivity:

    Human
  • Immunogen:

    The immunogen is a synthetic peptide directed towards the middle region of human BCAS1
  • Target:

    This gene resides in a region at 20q13 which is amplified in a variety of tumor types and associated with more aggressive tumor phenotypes. Among the genes identified from this region, it was found to be highly expressed in three amplified breast cancer cell lines and in one breast tumor without amplification at 20q13.2. However, this gene is not in the common region of maximal amplification and its expression was not detected in the breast cancer cell line MCF7, in which this region is highly amplified. Although not consistently expressed, this gene is a candidate oncogene. Two transcript variants encoding different isoforms have been found for this gene.
  • Clonality:

    Polyclonal
  • Type:

    Polyclonal Antibody
  • Sequence:

    VTTPEPAKEGTKEKSGPTSLPLGKLFWKKSVKEDSVPTGAEENVVCESPV
  • Applications:

    WB
  • Purification:

    Affinity purified
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Concentration:

    0.5 mg/ml
  • Format:

    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  • Reconstitution:

    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
  • Molecular Weight:

    62 kDa
  • Protein Length:

    167
  • NCBI Gene Symbol:

    BCAS1
  • Host or Source:

    Rabbit
  • Protein Name:

    Breast carcinoma-amplified sequence 1
  • Gene Name URL:

    BCAS1
  • CAS Number:

    9007-83-4
  • Nucleotide Accession Number:

    NM_003657.2