MAGEA6 Antibody - C-terminal region

• Gene Name:

  Melanoma antigen family A6

• Gene Aliases:

  CT1.6, MAGE6, MAGE3B, MAGE-3b

• Gene ID:

  4105

• Swiss Prot:

  P43360

• Accession Number:

  NP_005354.1

• Reactivity:

  Human

• Immunogen:

  The immunogen is a synthetic peptide directed towards the C terminal region of human MAGEA6

• Target:

  This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Alternative splicing results in multiple transcript variants.

• Clonality:

  Polyclonal

• Type:

  Polyclonal Antibody

• Sequence:

  PGSDPACYEFLWGPRALIETSYVKVLHHMVKISGGPRISYPLLHEWALRE

• Applications:

  WB

• Purification:

  Affinity purified

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration:

  0.5 mg/ml

• Format:

  Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

• Reconstitution:

  For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

• Molecular Weight:

  35 kDa

• Protein Length:

  314

• NCBI Gene Symbol:

  MAGEA6

• Host or Source:

  Rabbit

• Protein Name:

  Melanoma-associated antigen 6

• Gene Name URL:

  MAGEA6

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  NM_005363.2