ATP1A3 Antibody - middle region (ARP60209_P050)

CAT:
247-ARP60209_P050
Size:
100 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
ATP1A3 Antibody - middle region (ARP60209_P050) - image 1

ATP1A3 Antibody - middle region (ARP60209_P050)

  • Gene Name:

    ATPase, Na+/K+ transporting, alpha 3 polypeptide
  • Gene Aliases:

    RDP, AHC2, CAPOS, DYT12, ATP1A1
  • Gene ID:

    478
  • Swiss Prot:

    P13637
  • Accession Number:

    NP_689509.1
  • Reactivity:

    Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
  • Immunogen:

    The immunogen for Anti-ATP1A3 antibody is: synthetic peptide directed towards the middle region of Human AT1A3
  • Target:

    The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta) . The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes an alpha 3 subunit. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
  • Partner Proteins:

    UBC; LGR4; CLN5; ATXN1
  • Clonality:

    Polyclonal
  • Type:

    Polyclonal Antibody
  • Sequence:

    KVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCSTILLQG
  • Applications:

    WB
  • Purification:

    Affinity purified
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Concentration:

    0.5 mg/ml
  • Homology:

    Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
  • Format:

    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  • Reconstitution:

    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
  • Molecular Weight:

    111 kDa
  • Protein Length:

    1013
  • NCBI Gene Symbol:

    ATP1A3
  • Host or Source:

    Rabbit
  • Protein Name:

    Sodium/potassium-transporting ATPase subunit alpha-3
  • Gene Name URL:

    ATP1A3
  • CAS Number:

    9007-83-4