CRYM antibody - middle region (ARP51982_P050)

• Gene Name:

  Crystallin, mu

• Gene Aliases:

  THBP, DFNA40

• Gene ID:

  1428

• Swiss Prot:

  D5MNX0

• Accession Number:

  NP_001014444

• Reactivity:

  Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit

• Immunogen:

  The immunogen is a synthetic peptide directed towards the middle region of human CRYM

• Target:

  Crystallins are separated into two classes: taxon-specific and ubiquitous. The former class is also called phylogenetically-restricted crystallins. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. This gene encodes a taxon-specific crystallin protein that binds NADPH and has sequence similarity to bacterial ornithine cyclodeaminases. The encoded protein does not perform a structural role in lens tissue, and instead it binds thyroid hormone for possible regulatory or developmental roles. Mutations in this gene have been associated with autosomal dominant non-syndromic deafness. Multiple alternatively spliced transcript variants have been found for this gene.

• Partner Proteins:

  TERF1; C7orf25; CDC37

• Clonality:

  Polyclonal

• Type:

  Polyclonal Antibody

• Sequence:

  AHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFA

• Applications:

  WB

• Purification:

  Affinity Purified

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration:

  0.5 mg/ml

• Homology:

  Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%

• Format:

  Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

• Reconstitution:

  For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

• Molecular Weight:

  30kDa

• Protein Length:

  272

• NCBI Gene Symbol:

  CRYM

• Host or Source:

  Rabbit

• Protein Name:

  Thiomorpholine-carboxylate dehydrogenase

• Gene Name URL:

  CRYM

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  NM_001014444