Pard6b Antibody - N-terminal region

CAT:
247-ARP42917_P050-25UL
Size:
25 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Pard6b Antibody - N-terminal region - image 1

Pard6b Antibody - N-terminal region

  • Gene Name:

    Par-6 partitioning defective 6 homolog gamma (C. elegans)
  • Gene Aliases:

    Par6b, AV025615
  • Gene ID:

    58220
  • Swiss Prot:

    Q9JK83
  • Accession Number:

    NP_067384
  • Reactivity:

    Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
  • Immunogen:

    The immunogen is a synthetic peptide directed towards the N-terminal region of MOUSE Pard6b
  • Target:

    Pard6b is a adapter protein involved in asymmetrical cell division and cell polarization processes. It is probably involved in formation of epithelial tight junctions. Association with PARD3 may prevent the interaction of PARD3 with F11R/JAM1, thereby preventing tight junction assembly. The PARD6-PARD3 complex links GTP-bound Rho small GTPases to atypical protein kinase C proteins.
  • Partner Proteins:

    Llgl1
  • Clonality:

    Polyclonal
  • Type:

    Polyclonal Antibody
  • Sequence:

    SKFGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLVGYADIHGDLL
  • Applications:

    WB, IHC
  • Purification:

    Affinity Purified
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Concentration:

    0.5 mg/ml
  • Homology:

    Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 77%; Rat: 100%; Zebrafish: 85%
  • Format:

    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  • Reconstitution:

    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
  • Molecular Weight:

    40kDa
  • Protein Length:

    371
  • NCBI Gene Symbol:

    PARD6B
  • Host or Source:

    Rabbit
  • Protein Name:

    Partitioning defective 6 homolog beta
  • Gene Name URL:

    Pard6b
  • CAS Number:

    9007-83-4
  • Nucleotide Accession Number:

    NM_021409