ASPN Antibody - middle region

CAT:
247-ARP42487_T100-25UL
Size:
25 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
ASPN Antibody - middle region - image 1

ASPN Antibody - middle region

  • Description:

    Click here to learn more about Aviva's By-Request Conjugation Service.//here
  • Gene Name:

    Asporin
  • Gene Aliases:

    OS3, PLAP1, PLAP-1, SLRR1C
  • Gene ID:

    54829
  • Swiss Prot:

    Q5TBF3
  • Accession Number:

    NP_060150
  • Reactivity:

    Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
  • Immunogen:

    The immunogen is a synthetic peptide directed towards the middle region of human ASPN
  • Target:

    ASPN belongs to a family of leucine-rich repeat (LRR) proteins associated with the cartilage matrix. The name asporin reflects the unique aspartate-rich N terminus and the overall similarity to decorin.ASPN belongs to a family of leucine-rich repeat (LRR) proteins associated with the cartilage matrix. The name asporin reflects the unique aspartate-rich N terminus and the overall similarity to decorin (MIM 125255) (Lorenzo et al., 2001) .[supplied by OMIM].
  • Clonality:

    Polyclonal
  • Type:

    Polyclonal Antibody
  • Sequence:

    NKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENNK
  • Applications:

    IHC, WB
  • Purification:

    Protein A purified
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Concentration:

    1.0 mg/ml
  • Homology:

    Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 100%; Zebrafish: 90%
  • Format:

    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  • Reconstitution:

    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
  • Molecular Weight:

    43 kDa
  • Protein Length:

    380
  • NCBI Gene Symbol:

    ASPN
  • Host or Source:

    Rabbit
  • Protein Name:

    Asporin
  • Gene Name URL:

    ASPN
  • CAS Number:

    9007-83-4
  • Nucleotide Accession Number:

    NM_017680