PTF1A Antibody - N-terminal region

• Gene Name:

  Pancreas specific transcription factor, 1a

• Gene Aliases:

  P48, PACA, PAGEN2, bHLHa29, PTF1-p48

• Gene ID:

  256297

• Swiss Prot:

  Q7RTS3

• Accession Number:

  NP_835455

• Reactivity:

  Human, Mouse, Rat, Cow, Dog, Horse, Pig, Yeast

• Immunogen:

  The immunogen is a synthetic peptide directed towards the N terminal region of human PTF1A

• Target:

  PTF1A is a pancreas specific transcription factor. Mammalian studies have implicated important roles for the basic helix-loop-helix transcription factor PTF1A-p48 in the development of both exocrine and endocrine pancreas. This gene encodes a protein that is a component of the pancreas transcription factor 1 complex (PTF1) and is known to have a role in mammalian pancreatic development. The protein plays a role in determining whether cells allocated to the pancreatic buds continue towards pancreatic organogenesis or revert back to duodenal fates. The protein is thought to be involved in the maintenance of exocrine pancreas-specific gene expression including elastase 1 and amylase. Mutations in this gene cause cerebellar agenesis and loss of expression is seen in ductal type pancreas cancers. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

• Partner Proteins:

  TCF12

• Clonality:

  Polyclonal

• Type:

  Polyclonal Antibody

• Sequence:

  PLEDGDELLADEQAEVEFLSHQLHEYCYRDGACLLLQPAPPAAPLALAPP

• Applications:

  WB

• Purification:

  Affinity Purified

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration:

  0.5 mg/ml

• Homology:

  Cow: 100%; Dog: 93%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rat: 93%; Yeast: 75%

• Format:

  Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

• Reconstitution:

  For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

• Molecular Weight:

  35kDa

• Protein Length:

  328

• NCBI Gene Symbol:

  PTF1A

• Host or Source:

  Rabbit

• Protein Name:

  Pancreas transcription factor 1 subunit alpha

• Gene Name URL:

  PTF1A

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  NM_178161