Recombinant Pig Transcobalamin-1 (TCN1)

CAT:
399-CSB-CF023317PI-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Pig Transcobalamin-1 (TCN1) - image 1

Recombinant Pig Transcobalamin-1 (TCN1)

  • Product Name Alternative:

    Cobalophilin Haptocorrin Protein R Transcobalamin I
  • Abbreviation:

    Recombinant Pig TCN1 protein
  • Gene Name:

    TCN1
  • UniProt:

    P17630
  • Expression Region:

    25-416aa
  • Organism:

    Sus scrofa (Pig)
  • Target Sequence:

    CVVSEKDYSHLRLLISAMDNLEQIRGIYGASILLSQRLAGIQNPSLEEELSQRIQDDMNRRDMSNLTSGQLALIILAFGACKTPDVRFIHDHHLVEKLGEKFKEEIKNMEIHNSNPLTNYYQLSFDVLTLCLFRGNYSISNVTHYFNPENKNFNLSGHFSVDTGAVAVLALTCVKRSISNGKIKAAIKDSDTIQKYIESLVHKIQSEKMVVSLETRIAQEKLCRLSLSHQTITKMNQIAKKLWTRCLTHSQGVFRLPIAAAQILPALLGKTYLDVTKLLLVPKVQVNITDEPVPVVPTLSPENISVIYCVKINEISNCINITVFLDVMKAAQEKNSTIYGFTMTETPWGPYITSVQGIWANNNERTYWEHSEQQQITKPRSMGIMLSKMESI
  • Tag:

    N-terminal 6xHis-tagged
  • Type:

    Developed Protein
  • Source:

    In vitro E.coli expression system
  • Field of Research:

    Signal Transduction
  • Relevance:

    Binds vitamin B12 with femtomolar affinity and protects it from the acidic environment of the stomach. Binds to cobalamin and to cobalamin analogs such as cobinamide.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Binds vitamin B12 with femtomolar affinity and protects it from the acidic environment of the stomach (By similarity) . Binds to cobalamin and to cobalamin analogs such as cobinamide.
  • Molecular Weight:

    48.3 kDa
  • References & Citations:

    "Isolation and characterization of a cDNA encoding porcine gastric haptocorrin." Hewitt J.E., Seetharam B., Leykam J.F., Alpers D.H. Eur. J. Biochem. 189:125-130 (1990)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length of Mature Protein