Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3 (C1qtnf3)

CAT:
399-CSB-MP875360MO-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3 (C1qtnf3) - image 1

Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3 (C1qtnf3)

  • Product Name Alternative:

    Collagenous repeat-containing sequence 26 kDa protein Short name:CORS26 Secretory protein CORS26 Ctrp3
  • Abbreviation:

    Recombinant Mouse C1qtnf3 protein
  • Gene Name:

    C1qtnf3
  • UniProt:

    Q9ES30
  • Expression Region:

    23-246aa
  • Organism:

    Mus musculus (Mouse)
  • Target Sequence:

    QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK
  • Tag:

    N-terminal 10xHis-tagged
  • Type:

    In Stock Protein
  • Source:

    Mammalian cell
  • Field of Research:

    Metabolism
  • Endotoxin:

    Not test
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    26.6 kDa
  • References & Citations:

    "Role of specificity protein-1, PPARgamma, and pituitary protein transcription factor-1 in transcriptional regulation of the murine CORS-26 promoter." Schaffler A., Ehling A., Neumann E., Herfarth H., Paul G., Tarner I., Gay S., Buechler C., Scholmerich J., Muller-Ladner U. Biochim. Biophys. Acta 1678:150-156 (2004)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length of Mature Protein