Recombinant Mouse Complement C1q subcomponent subunit A (C1qa)

CAT:
399-CSB-YP003637MO-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Mouse Complement C1q subcomponent subunit A (C1qa) - image 1

Recombinant Mouse Complement C1q subcomponent subunit A (C1qa)

  • Product Name Alternative :

    C1qaComplement C1q subcomponent subunit A
  • Abbreviation :

    Recombinant Mouse C1qa protein
  • Gene Name :

    C1qa
  • UniProt :

    P98086
  • Expression Region :

    23-245aa
  • Organism :

    Mus musculus (Mouse)
  • Target Sequence :

    EDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRTGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA
  • Tag :

    N-terminal 6xHis-tagged
  • Type :

    In Stock Protein
  • Source :

    Yeast
  • Field of Research :

    Others
  • Relevance :

    C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complent syst. The collagen-like regions of C1q interact with the Ca2+-dependent C1r2C1s2 proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
  • Endotoxin :

    Not test
  • Purity :

    Greater than 90% as determined by SDS-PAGE.
  • Activity :

    Not Test
  • Form :

    Liquid or Lyophilized powder
  • Buffer :

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution :

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function :

    C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca (2+) -dependent C1r (2) C1s (2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
  • Molecular Weight :

    25.6 kDa
  • References & Citations :

    Proteome-wide characterization of N-glycosylation events by diagonal chromatography.Ghesquiere B., Van Damme J., Martens L., Vandekerckhove J., Gevaert K.J. Proteome Res. 5:2438-2447 (2006)
  • Storage Conditions :

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length :

    Full Length of Mature Protein

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide