Recombinant Human Complement C1q subcomponent subunit A (C1QA)

CAT:
399-CSB-BP003637HU-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Complement C1q subcomponent subunit A (C1QA) - image 1

Recombinant Human Complement C1q subcomponent subunit A (C1QA)

  • Product Name Alternative :

    C1qa; C1QA_HUMAN; Complement C1q subcomponent subunit A; Complement component 1 q subcomponent A chain; Complement component 1 q subcomponent alpha polypeptide; Complement component C1q A chain
  • Abbreviation :

    Recombinant Human C1QA protein
  • Gene Name :

    C1QA
  • UniProt :

    P02745
  • Expression Region :

    23-245aa
  • Organism :

    Homo sapiens (Human)
  • Target Sequence :

    EDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA
  • Tag :

    N-terminal 10xHis-tagged and C-terminal Myc-tagged
  • Type :

    Developed Protein
  • Source :

    Baculovirus
  • Field of Research :

    Immunology
  • Relevance :

    C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca2+-dependent C1r2C1s2 proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
  • Endotoxin :

    Not test
  • Purity :

    Greater than 85% as determined by SDS-PAGE.
  • Activity :

    Not Test
  • Form :

    Liquid or Lyophilized powder
  • Buffer :

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution :

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function :

    C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca (2+) -dependent C1r (2) C1s (2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
  • Molecular Weight :

    27.7 kDa
  • References & Citations :

    "Completion of the amino acid sequences of the A and B chains of subcomponent C1q of the first component of human complement." Reid K.B.M., Gagnon J., Frampton J. Biochem. J. 203:559-569 (1982)
  • Storage Conditions :

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length :

    Full Length of Mature Protein

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide