Recombinant Human Sperm-egg fusion protein Juno (IZUMO1R)

CAT:
399-CSB-EP008789HUb0-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Sperm-egg fusion protein Juno (IZUMO1R) - image 1

Recombinant Human Sperm-egg fusion protein Juno (IZUMO1R)

  • Product Name Alternative:

    Folate receptor 4 (Folate receptor delta) (FR-delta) (IZUMO1 receptor protein JUNO) (FOLR4) (JUNO)
  • Abbreviation:

    Recombinant Human IZUMO1R protein
  • Gene Name:

    IZUMO1R
  • UniProt:

    A6ND01
  • Expression Region:

    20-250aa
  • Organism:

    Homo sapiens (Human)
  • Target Sequence:

    GDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTTSWEAHLDVSPLYNFSLFHCGLLMPGCRKHFIQAICFYECSPNLGPWIQPVGSLGWEVAPSGQGERVVNVPLCQEDCEEWWEDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKASPERRNSGRCLQKWFEPAQGNPNVAVARLFASSAPSWELSYTIMVCSLFLPFLS
  • Tag:

    N-terminal 10xHis-tagged
  • Type:

    Developed Protein
  • Source:

    E.coli
  • Field of Research:

    Others
  • Relevance:

    Receptor for IZUMO1 present at the cell surface of oocytes, which is essential for species-specific gamete recognition and fertilization. The IZUMO1:IZUMO1R/JUNO interaction is a necessary adhesion event between sperm and egg that is required for fertilization but is not sufficient for cell fusion. The ligand-receptor interaction probably does not act as a membrane 'fusogen'. Does not bind folate.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    32.4 kDa
  • References & Citations:

    "A glycan-phosphatidylinositol-specific phospholipase D in human serum." Davitz M.A., Hereld D., Shak S., Krakow J., Englund P.T., Nussenzweig V. Science 238:81-84 (1987)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length of Mature Protein