Recombinant Human Sperm mitochondrial-associated cysteine-rich protein (SMCP)

CAT:
399-CSB-EP021820HU-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Sperm mitochondrial-associated cysteine-rich protein (SMCP) - image 1

Recombinant Human Sperm mitochondrial-associated cysteine-rich protein (SMCP)

  • Product Name Alternative:

    HSMCSGEN1 ; MCS ; MCSP ; MCSP_HUMAN; Mitochondrial capsule selenoprotein; SMCP; Sperm mitochondria associated cysteine rich protein; Sperm mitochondrial-associated cysteine-rich protein
  • Abbreviation:

    Recombinant Human SMCP protein
  • Gene Name:

    SMCP
  • UniProt:

    P49901
  • Expression Region:

    1-116aa
  • Organism:

    Homo sapiens (Human)
  • Target Sequence:

    MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQTQDKGCQTQQQPHSPQNESRPSK
  • Tag:

    N-terminal GST-tagged
  • Type:

    Developed Protein
  • Source:

    E.coli
  • Field of Research:

    Developmental Biology
  • Relevance:

    Involved in sperm motility. Its absence is associated with genetic background dependent male infertility. Infertility may be due to reduced sperm motility in the fale reproductive tract and inability to penetrate the oocyte zona pellucida .
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Involved in sperm motility. Its absence is associated with genetic background dependent male infertility. Infertility may be due to reduced sperm motility in the female reproductive tract and inability to penetrate the oocyte zona pellucida (By similarity) .
  • Molecular Weight:

    39.8 kDa
  • References & Citations:

    Isolation, expression, and chromosomal localization of the human mitochondrial capsule selenoprotein gene (MCSP) .Aho H., Schwemmer M., Tessmann D., Murphy D., Mattei M.-G., Engel W., Adham I.M.Genomics 32:184-190 (1996)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length