Recombinant Plasmodium falciparum Erythrocyte-binding antigen 175, partial

• Product Name Alternative:

  Erythrocyte-binding antigen 175; EBA-175

• Abbreviation:

  Recombinant Plasmodium falciparum Erythrocyte-binding antigen 175 protein, partial

• UniProt:

  P19214

• Expression Region:

  634-833aa

• Organism:

  Plasmodium falciparum (isolate Camp / Malaysia)

• Target Sequence:

  GDDYCQDKTKMIETLKVECKEKPCEDDNCKSKCNSYKEWISKKKEEYNKQAKQYQEYQKGNNYKMYSEFKSIKPEVYLKKYSEKCSNLNFEDEFKEELHSDYKNKCTMCPEVKDVPISIIRNNEQTSQEAVPEENTEIAHRTETPSISEGPKGNEQKERDDDSLSKISVSPENSRPETDAKDTSNLLKLKGDVDISMPKA

• Tag:

  N-terminal 10xHis-tagged

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Others

• Relevance:

  Binds to host erythrocytes; may act as bridge between erythrocytes and merozoites.

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Binds to host erythrocytes; may act as bridge between erythrocytes and merozoites.

• Molecular Weight:

  28.7 kDa

• References & Citations:

  "Primary structure of the 175K Plasmodium falciparum erythrocyte binding antigen and identification of a peptide which elicits antibodies that inhibit malaria merozoite invasion." Sim B.K., Orlandi P.A., Haynes J.D., Klotz F.W., Carter J.M., Camus D., Zegans M.E., Chulay J.D. J. Cell Biol. 111:1877-1884 (1990)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial