Recombinant Plasmodium falciparum VAR2CSA DBL5

CAT:
399-CSB-BP2690PLO-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Plasmodium falciparum VAR2CSA DBL5 - image 1

Recombinant Plasmodium falciparum VAR2CSA DBL5

  • Product Name Alternative:

    /
  • Abbreviation:

    Recombinant Plasmodium falciparum VAR2CSA DBL5 protein
  • UniProt:

    ACM48350.1
  • Expression Region:

    1-353aa
  • Organism:

    Plasmodium falciparum
  • Target Sequence:

    RCFDDQTKMKVCDLIGDAIGCKDKTKLDELDEWNDMDLRDPYNKYKGVLIPPRRRQLCFSRIVRGPANLRNLNEFKEEILKGAQSEGKFLGNYYNEDKDKEKKEDRKEKALEAMKNSFYDYEYIIKGSDILENIQFKDIKRKLDKLLTKETNNNTKKAEDWWETNKKSIWNAMLCGYKKSGNKIIDPSWCTIPTTEKTPQFLRWIKEWGTNVCIQKEKYKEYVKSECSNVPNNNLGSQASESTKCTSEIRKYQEWSRKRSIQWEAISERYKKYKGMDEFKNVFNNANEPDANEYLKEHCSKCPCGFNDMEEITKYTNIGNEAFNTIIEKVKIPAELEDVIYRLKHHEYNSNDY
  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged
  • Type:

    In Stock Protein
  • Source:

    Baculovirus
  • Field of Research:

    Others
  • Endotoxin:

    Not test
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    45.8 kDa
  • References & Citations:

    Induction of adhesion-inhibitory antibodies against placental Plasmodium falciparum parasites by using single domains of VAR2CSA Nielsen, M.A., Pinto, V.V., Resende, M., Dahlback, M., Ditlev, S.B., Theander, T.G. and Salanti, A. Infect. Immun. 77 (6), 2482-2487 (2009)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length