Products for Research Use Only
RegisterLogin

LACTB2, Human (GST)

CAT: 0804-HY-P70853-01Size: 10 µgDry Ice: YesHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P70853-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
As an endoribonuclease, LACTB2 protein preferentially cleaves the 3' purine-pyrimidine dinucleotide motif within single-stranded RNA, producing a cleavage product with a free 3'-OH group. It is worth noting that its enzymatic activity is only directed against single-stranded RNA and does not extend to double-stranded RNA or DNA. LACTB2 Protein, Human (GST) is the recombinant human-derived LACTB2 protein, expressed by E. coli , with N-GST labeled tag.
Product Name Alternative
LACTB2 Protein, Human (GST), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/lactb2-protein-human-gst.html
Smiles
MAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHL
Molecular Formula
51110 (Gene_ID) Q53H82 (M1-L288) (Accession)
Molecular Weight
Approximately 56 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-RS07490LACTB2 Human Pre-designed siRNA Set A
HY-P88685LACTB2 Antibody (YA8369, Mouse)
HY-RS26676Lactb2 Rat Pre-designed siRNA Set A
HY-RS20172Lactb2 Mouse Pre-designed siRNA Set A
HY-P705432IL1B, Human (GST)
HY-P704096VAV1, Human (GST)
HY-P704074CHMP1B, Human (GST)
HY-P72192-01FCGRT, Human (GST)
HY-P701932ADH6, Human (GST)
HY-P702861ATP6V0D1, Human (GST)

Alternative Products

CatalogName
C149-01Recombinant Human LACTB2 (N-GST)
P516572LACTB2 Protein (N-GST, Human)
TMPJ-01157-01LACTB2 Protein, Human, Recombinant (GST)
KMH1316-01Recombinant Human LACTB2 Protein, Gst Tag
PR01975Recombinant Human LACTB2 Protein, N-GST
PKSH033268-01Recombinant Human LACTB2 Protein (GST Tag)
MBS8432615-01Human LACTB2 Recombinant Protein N-GST Tag
IHULACTB2RNGST50UGHuman LACTB2 Recombinant Protein N-GST Tag 50UG
GTR19024500-01Recombinant Human β-Lactamase-Like Protein 2/LACTB2 (N-GST)
ARP5465-01Recombinant Human β-Lactamase-Like Protein 2/LACTB2 Protein (N-GST)

Popular Products