Recombinant Mouse Beta-synuclein (Sncb)

CAT:
399-CSB-EP838720MO-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Mouse Beta-synuclein (Sncb) - image 1

Recombinant Mouse Beta-synuclein (Sncb)

  • Product Name Alternative :

    Sncb; Beta-synuclein
  • Abbreviation :

    Recombinant Mouse Sncb protein
  • Gene Name :

    Sncb
  • UniProt :

    Q91ZZ3
  • Expression Region :

    1-133aa
  • Organism :

    Mus musculus (Mouse)
  • Target Sequence :

    MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTSGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKKEEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDSPQEEYQEYEPEA
  • Tag :

    Tag-Free
  • Type :

    Developed Protein
  • Source :

    E.coli
  • Field of Research :

    Others
  • Relevance :

    May be involved in neuronal plasticity.
  • Endotoxin :

    Not test
  • Purity :

    Greater than 85% as determined by SDS-PAGE.
  • Activity :

    Not Test
  • Form :

    Liquid or Lyophilized powder
  • Buffer :

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution :

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function :

    May be involved in neuronal plasticity.
  • Molecular Weight :

    14.1 kDa
  • References & Citations :

    "Genomic organization, chromosome location, and expression analysis of mouse beta-synuclein, a candidate for involvement in neurodegeneration." Sopher B.L., Koszdin K.L., McClain M.E., Myrick S.B., Martinez R.A., Smith A.C., La Spada A.R. Cytogenet. Cell Genet. 93:117-123 (2001)
  • Storage Conditions :

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length :

    Full Length

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide