Recombinant Mouse Ephrin-B3 (Efnb3), partial

CAT: 0399-CSB-YP007467MO-01Size: 20 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0399-CSB-YP007467MO-01Size:20 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Product Name Alternative

Efnb3Ephrin-B3

Abbreviation

Recombinant Mouse Efnb3 protein, partial

Gene Name

Efnb3

UniProt

O35393

Expression Region

28-227aa

Organism

Mus musculus (Mouse)

Target Sequence

LSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPSYEFYKLYLVEGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSAEPGRDTIPGDPSSNATSRGAEGPLPPPSMPA

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Cell surface transmbrane ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. May play a pivotal role in forebrain function. Binds to, and induce the collapse of, commissural axons/growth cones in vitro. May play a role in constraining the orientation of longitudinally projecting axons.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. May play a pivotal role in forebrain function. Binds to, and induce the collapse of, commissural axons/growth cones in vitro. May play a role in constraining the orientation of longitudinally projecting axons.

Molecular Weight

24 kDa

References & Citations

Ephrin-B3, a ligand for the receptor EphB3, expressed at the midline of the developing neural tube.Bergemann A.D., Zhang L., Chiang M.-K., Brambilla R., Klein R., Flanagan J.G.Oncogene 16:471-480 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

UniProtKB · O35393

Ephrin-B3

EFNB3_MOUSE · Mus musculus

View on UniProt ↗

Primary accession: O35393
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: Efnb3
Protein existence: 1: Evidence at protein level
Organism: Mus musculus (Mouse)
Taxonomy ID: 10090
Alternative names: —
EC number: —
Processing: Precursor
Secondary accessions: —

Protein keywords

Technical term

3D-structureReference proteome

Molecular function

Developmental protein

Biological process

DifferentiationNeurogenesis

PTM

Disulfide bondGlycoproteinMethylationPhosphoprotein

Cellular component

Membrane

Domain

SignalTransmembraneTransmembrane helix

Related Products

Catalog	Name
CSB-PA007934-01	Phospho-EFNB1/EFNB2/EFNB3 (Y324) Antibody
CSB-PA142593	Phospho-EFNB1/EFNB2/EFNB3 (Tyr324) Antibody
CSB-AP005771MO	Recombinant Mouse Ephrin-A1 (Efna1), partial (Active)
CSB-EP361017CRM1-01	Recombinant Coxsackievirus B3 Genome polyprotein, partial
CSB-MP007464HU1-01	Recombinant Human Ephrin-A5 (EFNA5), partial
CSB-EP897502HU-01	Recombinant Human Protocadherin gamma-B3 (PCDHGB3), partial
CSB-PA272368	EFNB3 Antibody
CSB-PA007935-01	EFNB3 Antibody
CSB-PA007467LA01MO-01	Efnb3 Antibody
CSB-PA007467ESR1HU-01	EFNB3 Antibody

Alternative Products

Catalog	Name
AP70260-01	Recombinant Mouse Ephrin-B3(Efnb3), partial
GTR19027827-01	Recombinant Mouse Ephrin-B3 (Efnb3), partial
AP72537	Recombinant Mouse Ephrin-B3 (Efnb3) , partial
MBS1371413-01	Recombinant Human Ephrin-B3 (EFNB3), partial
MBS9929406-01	Mouse Ephrin B3 (EFNB3) ELISA Kit
MBS2800148-01	Mouse Ephrin-B3 (EFNB3) ELISA Kit
D2070	Ephrin-B3 (EFNB3) Mouse ELISA Kit
MBS9149018-01	Recombinant Mouse Ephrin-B3/EFNB3 Protein
MBS9318751-01	Mouse Ephrin-B3, EFNB3 ELISA Kit
TMPY-00598-01	Ephrin B3/EFNB3 Protein, Mouse, Recombinant (hFc)