Recombinant Mouse Angiogenin-4 (Ang4)

• Product Name Alternative:

  Ang4Angiogenin-4; EC 3.1.27.-

• Abbreviation:

  Recombinant Mouse Ang4 protein

• Gene Name:

  Ang4

• UniProt:

  Q3TMQ6

• Expression Region:

  25-144aa

• Organism:

  Mus musculus (Mouse)

• Target Sequence:

  QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP

• Tag:

  N-terminal 6xHis-sumostar-tagged

• Type:

  In Stock Protein

• Source:

  Yeast

• Field of Research:

  Cardiovascular

• Relevance:

  Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro) . Has low ribonuclease activity (in vitro) . Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts (in vitro)

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro) . Has low ribonuclease activity (in vitro) . Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts (in vitro) .

• Molecular Weight:

  29.9 kDa

• References & Citations:

  "Angiogenins: a new class of microbicidal proteins involved in innate immunity." Hooper L.V., Stappenbeck T.S., Hong C.V., Gordon J.I. Nat. Immunol. 4:269-273 (2003)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length of Mature Protein