Recombinant Mouse Single Ig IL-1-related receptor (Sigirr), partial

• Product Name Alternative:

  Single Ig IL-1R-related molecule Single immunoglobulin domain-containing IL1R-related protein Toll/interleukin-1 receptor 8 Short name: TIR8

• Abbreviation:

  Recombinant Mouse Sigirr protein, partial

• Gene Name:

  Sigirr

• UniProt:

  Q9JLZ8

• Expression Region:

  1-117aa

• Organism:

  Mus musculus (Mouse)

• Target Sequence:

  MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

• Tag:

  N-terminal 6xHis-SUMO-tagged

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Immunology

• Relevance:

  Acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. Attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through an TIR-TIR domain interaction with TLR4. Through its Extracellular domain interferes with the heterodimerization of Il1R1 and IL1RAP (By similarity) .

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. Attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through an TIR-TIR domain interaction with TLR4. Through its extracellular domain interferes with the heterodimerization of Il1R1 and IL1RAP (By similarity) .

• Molecular Weight:

  28.7 kDa

• References & Citations:

  "Intestinal inflammation in mice deficient in Tir8, an inhibitory member of the IL-1 receptor family."Garlanda C., Riva F., Polentarutti N., Buracchi C., Sironi M., De Bortoli M., Muzio M., Bergottini R., Scanziani E., Vecchi A., Hirsch E., Mantovani A.Proc. Natl. Acad. Sci. U.S.A. 101:3522-3526 (2004)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial