Recombinant Bacillus anthracis Single-stranded DNA-binding protein (ssb)

CAT: 0399-CSB-EP770616BQE-01Size: 10 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0399-CSB-EP770616BQE-01Size:10 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Product Name Alternative

Ssb; ssb-1; BA_5722; GBAA_5722; BAS5326Single-stranded DNA-binding protein; SSB

Abbreviation

Recombinant Bacillus anthracis ssb protein

Gene Name

Ssb

UniProt

Q81JI3

Expression Region

1-172aa

Organism

Bacillus anthracis

Target Sequence

MNRVILVGRLTKDPDLRYTPNGVAVATFTLAVNRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTRNYEGQDGKRVYVTEVLAESVQFLEPRNGGGEQRGSFNQQPSGAGFGNQSSNPFGQSSNSGNQGNQGNSGFTKNDDPFSNVGQPIDISDDDLPF

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Plays an important role in DNA replication, recombination and repair. Binds to ssDNA and to an array of partner proteins to recruit th to their sites of action during DNA metabolism.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays an important role in DNA replication, recombination and repair. Binds to ssDNA and to an array of partner proteins to recruit them to their sites of action during DNA metabolism.

Molecular Weight

34.7 kDa

References & Citations

The genome sequence of Bacillus anthracis Ames and comparison to closely related bacteria.Read T.D., Peterson S.N., Tourasse N.J., Baillie L.W., Paulsen I.T., Nelson K.E., Tettelin H., Fouts D.E., Eisen J.A., Gill S.R., Holtzapple E.K., Okstad O.A., Helgason E., Rilstone J., Wu M., Kolonay J.F., Beanan M.J., Dodson R.J. , Brinkac L.M., Gwinn M.L., DeBoy R.T., Madpu R., Daugherty S.C., Durkin A.S., Haft D.H., Nelson W.C., Peterson J.D., Pop M., Khouri H.M., Radune D., Benton J.L., Mahamoud Y., Jiang L., Hance I.R., Weidman J.F., Berry K.J., Plaut R.D., Wolf A.M., Watkins K.L., Nierman W.C., Hazen A., Cline R.T., Redmond C., Thwaite J.E., White O., Salzberg S.L., Thomason B., Friedlander A.M., Koehler T.M., Hanna P.C., Kolstoe A.-B., Fraser C.M.Nature 423:81-86 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

UniProtKB · Q81JI3

Single-stranded DNA-binding protein

SSB_BACAN · Bacillus anthracis

View on UniProt ↗

Primary accession: Q81JI3
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: ssb
Protein existence: 3: Inferred from homology
Organism: Bacillus anthracis
Taxonomy ID: 1392
Alternative names: SSB
EC number: —
Processing: —
Secondary accessions: Q6HQ25, Q6KJG9

Protein keywords

Biological process

DNA damageDNA recombinationDNA repairDNA replication

Molecular function

DNA-binding

Technical term

Reference proteome

Related Products

Catalog	Name
CSB-EP654323BBC-01	Recombinant Bacillus phage phi29 Single-stranded DNA-binding protein (5)
CSB-PA366021HA01EEB-01	Single-stranded DNA-binding protein Antibody
CSB-PA366021HB01EEB-01	Single-stranded DNA-binding protein Antibody, HRP conjugated
CSB-PA366021HC01EEB-01	Single-stranded DNA-binding protein Antibody, FITC conjugated
CSB-PA366021HD01EEB-01	Single-stranded DNA-binding protein Antibody, Biotin conjugated
CSB-EP323579ENV-01	Recombinant Escherichia coli Plasmid-derived single-stranded DNA-binding protein (ssbF)
CSB-EP022706EDZe1-01	Recombinant Enterobacteria phage T4 Single-stranded DNA-binding protein (32)
CSB-BP001487HU-01	Recombinant Human Single-stranded DNA cytosine deaminase (AICDA)
CSB-YP001487MO-01	Recombinant Mouse Single-stranded DNA cytosine deaminase (Aicda)
CSB-YP022706EDZ-01	Recombinant Enterobacteria phage T4 Single-stranded DNA-binding protein (32)

Alternative Products

Catalog	Name
abx300106-01	Single-Stranded DNA-Binding Protein (ssb) Antibody
abx300107-01	Single-Stranded DNA-Binding Protein (ssb) Antibody (HRP)
02-044	Taq SSB (Single-Stranded DNA Binding) protein, functional
S1013-86R-01	Single-Stranded DNA Binding Protein, E. coli (SSB)
MBS1221389-01	Recombinant Bacillus subtilis Single-stranded DNA-binding protein ssb (ssb)
abx300108-01	Single-Stranded DNA-Binding Protein (ssb) Antibody (FITC)
abx300109-01	Single-Stranded DNA-Binding Protein (ssb) Antibody (Biotin)
MBS1417091-01	Recombinant Corynebacterium glutamicum Single-stranded DNA-binding protein (ssb)
MBS1363639-01	Recombinant Enterococcus faecalis Single-stranded DNA-binding protein (ssb)
MBS1357767-01	Recombinant Chlamydophila caviae Single-stranded DNA-binding protein (ssb)