Recombinant Rat Interleukin-18 (Il18)

• Product Name Alternative:

  Interferon gamma-inducing factor ; IFN-gamma-inducing factorInterleukin-1 gamma ; IL-1 gamma

• Abbreviation:

  Recombinant Rat Il18 protein

• Gene Name:

  Il18

• UniProt:

  P97636

• Expression Region:

  37-194aa

• Organism:

  Rattus norvegicus (Rat)

• Target Sequence:

  HFGRLHCTTAVIRSINDQVLFVDKRNPPVFEDMPDIDRTANESQTRLIIYMYKDSEVRGLAVTLSVKDGRMSTLSCKNKIISFEEMNPPENIDDIKSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLVLKRKDENGDKSVMFTLTNLHQS

• Tag:

  N-terminal 6xHis-tagged

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Others

• Relevance:

  Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.

• Molecular Weight:

  22.3 kDa

• References & Citations:

  Cloning of the cDNA for interleukin-18 in PC12 and expression in Escherichia coli.Kim S.-J., Kim C.-S., Song K.-Y., Kim J.-S., Jung K.-S. IL-18 translational inhibition restricts IFN-gamma expression in crescentic glomerulonephritis.Garcia G.E., Xia Y., Ku G., Johnson R.J., Wilson C.B., Feng L.Kidney Int. 64:160-169 (2003)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length of Mature Protein