Recombinant Rat Interleukin-18 (Il18)

CAT:
399-CSB-RP176194r-02
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Rat Interleukin-18 (Il18) - image 1

Recombinant Rat Interleukin-18 (Il18)

  • Product Name Alternative:

    Interferon gamma-inducing factor ; IFN-gamma-inducing factorInterleukin-1 gamma ; IL-1 gamma
  • Abbreviation:

    Recombinant Rat Il18 protein
  • Gene Name:

    Il18
  • UniProt:

    P97636
  • Expression Region:

    37-194aa
  • Organism:

    Rattus norvegicus (Rat)
  • Target Sequence:

    HFGRLHCTTAVIRSINDQVLFVDKRNPPVFEDMPDIDRTANESQTRLIIYMYKDSEVRGLAVTLSVKDGRMSTLSCKNKIISFEEMNPPENIDDIKSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLVLKRKDENGDKSVMFTLTNLHQS
  • Tag:

    N-terminal 6xHis-tagged
  • Type:

    Developed Protein
  • Source:

    E.coli
  • Field of Research:

    Others
  • Relevance:

    Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.
  • Molecular Weight:

    22.3 kDa
  • References & Citations:

    Cloning of the cDNA for interleukin-18 in PC12 and expression in Escherichia coli.Kim S.-J., Kim C.-S., Song K.-Y., Kim J.-S., Jung K.-S. IL-18 translational inhibition restricts IFN-gamma expression in crescentic glomerulonephritis.Garcia G.E., Xia Y., Ku G., Johnson R.J., Wilson C.B., Feng L.Kidney Int. 64:160-169 (2003)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length of Mature Protein