Recombinant Mouse C-X-C motif chemokine 3 protein (Cxcl3)

• Product Name Alternative:

  Dendritic cell inflammatory protein 11

• Abbreviation:

  Recombinant Mouse Cxcl3 protein

• Gene Name:

  Cxcl3

• UniProt:

  Q6W5C0

• Expression Region:

  32-100aa

• Organism:

  Mus musculus (Mouse)

• Target Sequence:

  SELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS

• Tag:

  N-terminal 6xHis-tagged

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Others

• Relevance:

  Ligand for CXCR2. Has chotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Ligand for CXCR2. Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion.

• Molecular Weight:

  11.6 kDa

• References & Citations:

  IL-10-conditioned dendritic cells, decommissioned for recruitment of adaptive immunity, elicit innate inflammatory gene products in response to danger signals.Nolan K.F., Strong V., Soler D., Fairchild P.J., Cobbold S.P., Croxton R., Gonzalo J.-A., Rubio A., Wells M., Waldmann H.J. Immunol. 172:2201-2209 (2004)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length of Mature Protein