Recombinant Human Bone morphogenetic protein 3 (BMP3)

CAT: 0399-CSB-EP002739HU-01Size: 20 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0399-CSB-EP002739HU-01Size:20 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Product Name Alternative

Bone morphogenetic protein 3A ; BMP-3AOsteogenin

Abbreviation

Recombinant Human BMP3 protein

Gene Name

BMP3

UniProt

P12645

Expression Region

363-472aa

Organism

Homo sapiens (Human)

Target Sequence

QWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Developmental Biology

Relevance

Negatively regulates bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Negatively regulates bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification.

Molecular Weight

16.4 kDa

References & Citations

An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262 (2014)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

UniProtKB · P12645

Bone morphogenetic protein 3

BMP3_HUMAN · Homo sapiens

View on UniProt ↗

Primary accession: P12645
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: BMP3
Protein existence: 1: Evidence at protein level
Organism: Homo sapiens (Human)
Taxonomy ID: 9606
Alternative names: BMP-3
EC number: —
Processing: Precursor
Secondary accessions: Q4VAS5

Protein keywords

Technical term

3D-structureProteomics identificationReference proteome

Biological process

ChondrogenesisDifferentiationOsteogenesis

PTM

Cleavage on pair of basic residuesDisulfide bondGlycoprotein

Molecular function

CytokineDevelopmental proteinGrowth factor

Cellular component

Secreted

Domain

Signal

Related Products

Catalog	Name
CSB-EP002739MO-01	Recombinant Mouse Bone morphogenetic protein 3 (Bmp3)
CSB-EL002739HU-01	Human Bone morphogenetic protein 3 (BMP3) ELISA kit
CSB-EL002739MO-01	Mouse Bone morphogenetic protein 3 (BMP3) ELISA kit
CSB-EP002740HU-01	Recombinant Human Bone morphogenetic protein 4 (BMP4)
CSB-EP002740HUa0-01	Recombinant Human Bone morphogenetic protein 4 (BMP4)
CSB-EP002736HUa2-01	Recombinant Human Bone morphogenetic protein 2 (BMP2)
CSB-EP002740HUc7-01	Recombinant Human Bone morphogenetic protein 4 (BMP4)
CSB-EP002733HU-01	Recombinant Human Bone morphogenetic protein 1 (BMP1)
CSB-EP002744HU-01	Recombinant Human Bone morphogenetic protein 7 (BMP7)
CSB-EP002736HU-01	Recombinant Human Bone morphogenetic protein 2 (BMP2)

Alternative Products

Catalog	Name
308028-01	BMP3 (Bone morphogenetic Protein 3)
MBS6008467-01	BMP3, CT (BMP3, BMP3A, Bone morphogenetic protein 3, Bone morphogenetic protein 3A, Osteogenin)
MBS6278592-01	BMP3, CT (BMP3, BMP3A, Bone morphogenetic protein 3, Bone morphogenetic protein 3A, Osteogenin) (PE)
MBS6278584-01	BMP3, CT (BMP3, BMP3A, Bone morphogenetic protein 3, Bone morphogenetic protein 3A, Osteogenin) (Biotin)
MBS6278582-01	BMP3, CT (BMP3, BMP3A, Bone morphogenetic protein 3, Bone morphogenetic protein 3A, Osteogenin) (AP)
MBS6278585-01	BMP3, CT (BMP3, BMP3A, Bone morphogenetic protein 3, Bone morphogenetic protein 3A, Osteogenin) (FITC)
MBS6278583-01	BMP3, CT (BMP3, BMP3A, Bone morphogenetic protein 3, Bone morphogenetic protein 3A, Osteogenin) (APC)
308096-01	BMP3 (Bone morphogenetic Protein 3) (HRP)
308095-01	BMP3 (Bone morphogenetic Protein 3) (FITC)
MBS2140142-01	Recombinant Bone Morphogenetic Protein 3 (BMP3)