Complement C8G, Human (His, solution)

CAT:
804-HY-P7824-02
Size:
50 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: Yes
Complement C8G, Human (His, solution) - image 1

Complement C8G, Human (His, solution)

  • Description :

    C8G/C8 γ is the γ subunit of the C8 protein of the complement system and is mainly localized in brain astrocytes. C8G/C8 γ is a neuroinflammation inhibitor that interacts with S1PR2 and jointly antagonizes the pro-inflammatory activity of S1P in microglia. Complement C8G Protein, Human (His, solution) is the recombinant human-derived Complement C8G protein, expressed by E. coli , with N-6*His labeled tag.
  • Product Name Alternative :

    Complement C8G Protein, Human (His, solution), Human, E. coli
  • UNSPSC :

    12352202
  • Type :

    Recombinant Proteins
  • Assay Protocol :

    https://www.medchemexpress.com/cytokines/complement-c8g-protein-human-his.html
  • Purity :

    98.0
  • Smiles :

    QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR
  • Molecular Formula :

    733 (Gene_ID) AAI13627.1 (Q21-R202) (Accession)
  • Molecular Weight :

    Approximately 22.0-23.0 kDa
  • Shipping Conditions :

    Dry ice.
  • Storage Conditions :

    Stored at -80°C for 1 year
  • Scientific Category :

    Recombinant Proteins

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide