VSIG4 Blocking Peptide

• Catalog number
  33R-9726
• Price
  Please ask
• Size
  100 ug

• Product Type
  Proteins
• Product Subtype
  Blocking Peptides
• Research Area
  Immunology
• Tag Conjugate
  VPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVS
• Type1
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Applications
  WB, IHC
• Shipping Info
  Blue Ice
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  VSIG4  
• Gene symbol
  VSIG4
• Short name
  VSIG4 Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  V-set and immunoglobulin domain containing 4 inhibiting short protein sequence
• Alternative technique
  control, peptides
• Alternative to gene target
  V-set and immunoglobulin domain containing 4, CRIg and Z39IG, VSIG4 and IDBG-73541 and ENSG00000155659 and 11326, protein binding, Plasma membranes, Vsig4 and IDBG-160903 and ENSMUSG00000044206 and 278180, VSIG4 and IDBG-637672 and ENSBTAG00000015769 and 614262

Gene info

• Identity
  HGNC:17032
• Gene
  VSIG4
• Long gene name
  V-set and immunoglobulin domain containing 4
• Synonyms
  • Z39IG
  • CRIg
• Synonyms name
  • complement receptor of the immunoglobulin superfamily
• GenBank acession
  • AJ132502
• Locus
  Xq12
• Discovery year
  2004-09-10
• Entrez gene record
  11326
• Pubmed identfication
  • 11004523
  • 17016555
  • 17016562
• RefSeq identity
  • NM_007268
• Classification
  • Complement system regulators and receptors
  • V-set domain containing
• VEGA ID
  OTTHUMG00000021727
• Locus Specific Databases
  • Global Variome shared LOVD

Similar products