Rabbit VSIG4 antibody
-
Catalog number70R-1905
-
PricePlease ask
-
Size100 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaImmunology
-
ImmunogenVSIG4 antibody was raised using the N terminal of VSIG4 corresponding to a region with amino acids VPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVS
-
SpecificityVSIG4 antibody was raised against the N terminal of VSIG4
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of VSIG4 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolVSIG4
-
Short nameRabbit VSIG4 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal VSIG4 antibody raised against the N terminal of VSIG4
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetV-set and immunoglobulin domain containing 4, CRIg and Z39IG, VSIG4 and IDBG-73541 and ENSG00000155659 and 11326, protein binding, Plasma membranes, Vsig4 and IDBG-160903 and ENSMUSG00000044206 and 278180, VSIG4 and IDBG-637672 and ENSBTAG00000015769 and 614262
-
Gene info
-
Identity
-
Gene
-
Long gene nameV-set and immunoglobulin domain containing 4
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2004-09-10
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Complement system regulators and receptors
- V-set domain containing
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data