Recombinant Mouse VSIG4 (C-6His)

• Catalog number
  CP83-10
• Price
  Please ask
• Size
  10 ug

• Description
  Recombinant Mouse V-Set and Ig Domain-Containing Protein 4 is produced by our Mammalian expression system and the target gene encoding His20-Pro187 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Mouse
• Origin
  Human cells
• Peptide sequence
  HPTLKTPESVTGTWKGDVKIQCIYDPLRGYRQVLVKWLVRHGSDSVTIFLRDSTGDHIQQAKYRGRLKVSHKVPGDVSLQINTLQMDDRNHYTCEVTWQTPDGNQVIRDKIIELRVRKYNPPRINTEAPTTLHSSLEATTIMSSTSDLTTNGTGKLEETIAGSGRNLPHHHHHH
• Estimated molecular weight
  19,7 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  See included datasheet or contact us for more information.
• UniProt number
  F6TUL9
• Other related products
• Test
  Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
• Latin name
  Mus musculus
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  VSIG4   C-6His  
• Gene symbol
  VSIG4
• Short name
  Recombinant Mouse VSIG4 (C-6His)
• Technique
  Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Host
  mouse
• Species
  Mouse, Mouses
• Alternative name
  Recombinant Mouse VSIG4 (C-6His)
• Alternative technique
  rec, murine
• Alternative to gene target
  V-set and immunoglobulin domain containing 4, CRIg and Z39IG, VSIG4 and IDBG-73541 and ENSG00000155659 and 11326, protein binding, Plasma membranes, Vsig4 and IDBG-160903 and ENSMUSG00000044206 and 278180, VSIG4 and IDBG-637672 and ENSBTAG00000015769 and 614262

Gene info

• Identity
  HGNC:17032
• Gene
  VSIG4
• Long gene name
  V-set and immunoglobulin domain containing 4
• Synonyms
  • Z39IG
  • CRIg
• Synonyms name
  • complement receptor of the immunoglobulin superfamily
• GenBank acession
  • AJ132502
• Locus
  Xq12
• Discovery year
  2004-09-10
• Entrez gene record
  11326
• Pubmed identfication
  • 11004523
  • 17016555
  • 17016562
• RefSeq identity
  • NM_007268
• Classification
  • Complement system regulators and receptors
  • V-set domain containing
• VEGA ID
  OTTHUMG00000021727
• Locus Specific Databases
  • Global Variome shared LOVD

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products