Recombinant Human KIR2DL4/CD158d/KIR103 (C-6His)

• Catalog number
  C310-1000
• Price
  Please ask
• Size
  1 mg

• Description
  Recombinant Human KIR2DL4 is produced by our Mammalian expression system and the target gene encoding Trp22-His242 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Human Cells
• Peptide sequence
  WAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRTGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDASDPLPVSVTGNPSSSWPSPTEPSFKTGIARHLHVDHHHHHH
• Estimated molecular weight
  25,34 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  Q99706
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  KIR2DL4/CD158d/KIR103   C-6His  
• Gene symbol
  KIR2DL4
• Short name
  Recombinant KIR2DL4/CD158d/KIR103 (C-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human KIR2DL4/CD158d/KIR103(C-6His)
• Alternative technique
  rec
• Alternative to gene target
  killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4, CD158D and G9P and KIR-103AS and KIR103 and KIR103AS, KIR2DL4 and IDBG-69383 and ENSG00000189013 and 3805, protein binding, Plasma membranes

Gene info

• Identity
  HGNC:6332
• Gene
  KIR2DL4
• Long gene name
  killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 4
• Synonyms gene name
  • killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4
• Synonyms
  • 103AS
  • 15.212
  • CD158D
• GenBank acession
  • X97229
• Locus
  19q13.42
• Discovery year
  1997-11-14
• Entrez gene record
  3805
• Pubmed identfication
  • 8946682
• RefSeq identity
  • NM_002255
• Classification
  • CD molecules
  • Killer cell immunoglobulin like receptors
• VEGA ID
  OTTHUMG00000065880
• Locus Specific Databases
  • IPD-KIR Database

MeSH Data

• Name
  Electrophoresis, Gel, Two-Dimensional
• Concept
  Scope note: Electrophoresis in which a second perpendicular electrophoretic transport is performed on the separate components resulting from the first electrophoresis. This technique is usually performed on polyacrylamide gels.
• Tree numbers
  • E05.196.401.250
  • E05.301.300.230
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products