Recombinant Human CD40/TNFRSF5/CD40L Receptor (C-Fc)

• Catalog number
  CD12-1000
• Price
  Please ask
• Size
  1 mg

• Description
  Recombinant Human CD40L Receptor is produced by our Mammalian expression system and the target gene encoding Glu21-Arg193 is expressed with a Fc tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Human Cells
• Peptide sequence
  EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Estimated molecular weight
  46,3 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  See included datasheet or contact us for more information.
• UniProt number
  P25942
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Additional description
  The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  CD40/TNFRSF5/CD40L   Receptor   C-Fc  
• Gene symbol
  CD40, CD40LG
• Short name
  Recombinant CD40/TNFRSF5/CD40L Receptor (C-Fc)
• Technique
  Recombinant, FC, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Recombinant Human CD40 (C-Fc)
• Alternative technique
  rec
• Alternative to gene target
  CD40 molecule, TNF receptor superfamily member 5, Bp50 and CDW40 and p50 and TNFRSF5, CD40 and IDBG-78904 and ENSG00000101017 and 958, ubiquitin protein ligase binding, Extracellular, Cd40 and IDBG-212533 and ENSMUSG00000017652 and 21939, BT.42498 and IDBG-643036 and ENSBTAG00000020736 and 286849

Gene info

• Identity
  HGNC:11919
• Gene
  CD40
• Long gene name
  CD40 molecule
• Synonyms gene
  • TNFRSF5
• Synonyms gene name
  • tumor necrosis factor receptor superfamily, member 5
  • CD40 molecule, TNF receptor superfamily member 5
• Synonyms
  • p50
  • Bp50
• GenBank acession
  • X60592
• Locus
  20q13.12
• Discovery year
  1993-08-27
• Entrez gene record
  958
• Pubmed identfication
  • 7687385
  • 2998589
• RefSeq identity
  • NM_001250
• Classification
  • CD molecules
  • Tumor necrosis factor receptor superfamily
• VEGA ID
  OTTHUMG00000033053
• Locus Specific Databases
  • CD40base: Mutation registry for CD40 deficiency (previously known as TNFRSF5base)
  • LRG_40

Gene info

• Identity
  HGNC:11935
• Gene
  CD40LG
• Long gene name
  CD40 ligand
• Synonyms gene
  • HIGM1
  • IMD3
  • TNFSF5
• Synonyms gene name
  • tumor necrosis factor (ligand) superfamily, member 5 (hyper-IgM syndrome)
• Synonyms
  • CD40L
  • TRAP
  • gp39
  • hCD40L
  • CD154
• Synonyms name
  • CD40 antigen ligand
  • tumor necrosis factor (ligand) superfamily member 5
  • T-B cell-activating molecule
  • TNF-related activation protein
  • hyper-IgM syndrome
• GenBank acession
  • X67878
• Locus
  Xq26.3
• Discovery year
  1989-06-30
• Entrez gene record
  959
• Pubmed identfication
  • 1427881
  • 7678782
• RefSeq identity
  • NM_000074
• Classification
  • CD molecules
  • Tumor necrosis factor superfamily
• VEGA ID
  OTTHUMG00000022512
• Locus Specific Databases
  • CD40Lbase: Mutation registry for X-linked Hyper-IgM syndrome
  • Global Variome shared LOVD
  • LRG_141

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products