LIF Receptor Antibody / LIFR
-
Catalog numberR32098
-
PricePlease ask
-
Size0.1mg
-
-
CategoryAntibody
-
Concentration0.5mg/ml if reconstituted with 0.2ml sterile DI water
-
FormAntigen affinity purified
-
ConjugationUnconjugated
-
ClonePolyclonal antibody
-
Recognised antigenLIF Receptor / LIFR
-
Host animalRabbit (Oryctolagus cuniculus)
-
ClonalityPolyclonal (rabbit origin)
-
Species reactivityHuman (Homo sapiens) ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
-
Tested applicationsWB
-
Recommended dilutionsWestern blot: 0.1-0.5ug/ml
-
NotesOptimal dilution of the LIFR antibody should be determined by the researcher.
-
Intented useThis LIFR antibodyis to be used only for research purposes and not for diagnostics..
-
UniprotP42702
-
PurityAntigen affinity
-
DescriptionLIFR also known as CD118 (Cluster of Differentiation 118), is a subunit of a receptor for leukemia inhibitory factor. This gene encodes a protein that belongs to the type I cytokine receptor family. This protein combines with a high-affinity converter subunit, gp130, to form a receptor complex that mediates the action of the leukemia inhibitory factor, a polyfunctional cytokine that is involved in cellular differentiation, proliferation and survival in the adult and the embryo. Mutations in this gene cause Schwartz-Jampel syndrome type 2, a disease belonging to the group of the bent-bone dysplasias. A translocation that involves the promoter of this gene, t(5;8)(p13;q12) with the pleiomorphic adenoma gene 1, is associated with salivary gland pleiomorphic adenoma, a common type of benign epithelial tumor of the salivary gland. Multiple splice variants encoding the same protein have been found for this gene.
-
ImmunogenAmino acids EWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLE of human LIFR were used as the immunogen for the LIFR antibody.
-
StorageAfter reconstitution, the LIFR antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
-
PropertiesIf you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
Additional descriptionThe receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
-
French translationanticorps
-
Gene target
-
Gene symbolLIF-AS1, LIFR-AS1, LIFR, LIF-AS2, LIF
-
Short nameAnti-LIF Receptor / LIFR
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
IsotypeRabbit IgG
-
Alternative nameAntibodies to LIF Receptor / LIFR
-
Alternative techniqueantibodies
-
Alternative to gene targetleukemia inhibitory factor, CDF and DIA and HILDA and MLPLI, LIF and IDBG-3968 and ENSG00000128342 and 3976, growth factor activity, Extracellular, Lif and IDBG-142317 and ENSMUSG00000034394 and 16878, LIF and IDBG-636335 and ENSBTAG00000007424 and 280840
-
Gene info
-
Identity
-
Gene
-
Long gene nameLIF antisense RNA 1
-
Synonyms
-
Locus
-
Discovery year2017-04-28
-
Pubmed identfication
-
Classification
- Antisense RNAs
Gene info
-
Identity
-
Gene
-
Long gene nameLIFR antisense RNA 1
-
Synonyms gene name
- LIFR antisense RNA 1 (non-protein coding)
-
GenBank acession
-
Locus
-
Discovery year2011-11-23
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Antisense RNAs
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameLIF receptor subunit alpha
-
Synonyms gene name
- leukemia inhibitory factor receptor
- leukemia inhibitory factor receptor alpha
- LIF receptor alpha
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1992-08-24
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Fibronectin type III domain containing
- CD molecules
- MicroRNA protein coding host genes
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameLIF antisense RNA 2
-
Locus
-
Discovery year2020-10-07
-
Entrez gene record
-
RefSeq identity
-
Classification
- Antisense RNAs
Gene info
-
Identity
-
Gene
-
Long gene nameLIF interleukin 6 family cytokine
-
Synonyms gene name
- leukemia inhibitory factor
- LIF, interleukin 6 family cytokine
-
Synonyms
-
Synonyms name
-
Locus
-
Discovery year1989-06-11
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Receptor ligands
- Interleukin 6 type cytokine family
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
