Human Recombinant Cpn10 Protein

  • Catalog number
    SPR-310C
  • Price
    Please ask
  • Size
    2x100 µg
  • Stock availability
    In Stock
  • Scientific context
    Chaperonin 10, otherwise known as Cpn10, (groES in E.coli) make up a family of small heart shock proteins with an approximate molecular mass of 10kDa (HSP10s). Cpn10 acts as a co-chaperone and interacts with the HSP60 family to promote proper folding of polypeptides. Cpn10 and Cpn60 both exhibit sevenfold axis of symmetry and function as a team in the protein folding and assembly process (1). Cpn10 has been located in human platelets, but is also present in human maternal serum (2, 3). It has been reported that human Cpn10 is identical with early pregnancy factor, which is involved in control over cell growth and development. This identification suggest that Cpn10 may act like a hormone in stressful situations such as pregnancy (4).
  • Protein target
    Cpn10
  • Protein reactivity
    Human
  • Certificate of analysis
    This product has been certified >90% pure using SDS-PAGE analysis.
  • Protein description
    Human Recombinant Cpn10 Protein
  • Other name
    10kDa Chaperonin Protein, Chaperonin 10 Protein, Cpn 10 Protein, EPF Protein, GROES Protein, Heat Shock 10kD protein1 Protein, HSP10 Protein, HSPE1 Protein
  • Primary research area
    Cancer, Heat Shock
  • Category
    Protein
  • Brand name
    none
  • Origin
    Recombinant
  • NCBI number
    NM_002157.2
  • Gene number
    3336
  • Protein number
    P61604
  • Verified applications
    WB, SDS-PAGE
  • Relevant bio activity
    Cpn10 Protein
  • Protein expression model
    E. coli
  • Protein charasterics
    See included datasheet.
  • Peptide sequence
    MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD
  • Protein purification
    Multi-Step Purified
  • Purity pourcentage
    >90% High purity
  • Recommended buffer for storage
    20mM Tris, pH7.5, 0.3M NaCl, 10% glycerol, 1 mM DTT
  • Protein concentration
    Lot/batch specific. See included datasheet.
  • Protein specificity
    ~10 kDa
  • Protein tag
    No tag
  • Storage recommendations
    -20°C
  • Shipping recommendations
    Blue Ice or 4°C
  • Supplementary useful information
    Please see included datasheet or contact us
  • Protein cell localization
    Mitochondrion Matrix
  • Bibliography
    1. Velez-Granell C.S., et al. (1994) J of Cell Science. 107(3):539-549. 2. Morton H., Hegh V., and Clunie G.J.A. (1974) Nature (London) 249: 459-460. 3. Cavanagh A.C., and Morton H. (1994) Eur. J. Biochem. 222: 551-560. 4. Minto M., et al. (1998) Molecular Cell Research. 1403 (2): 151-157.
  • Release date
    11-Sep-2009
  • PubMed number
    23775284
  • Tested applications
    Functional Assay
  • Tested species reactivity
    Human
  • Representative figure legend
    SDS-PAGE of 10kDa human Cpn10 protein (SPR-310). SDS-Page of human Cpn10 Protein (SPR-310)
  • Warnings
    Non-hazardous materials
  • Protein origin
    Canada
  • Total weight kg
    1.4
  • Net weight g
    0.2
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
    Cpn10   Protein  
  • Gene symbol
    HSPE1
  • Short name
    Recombinant Cpn10 Protein
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. StressMark proteins advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    H. sapiens Rec. Cpn10 Protein
  • Alternative technique
    rec
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee