DHODH Antibody

• Catalog number
  R32524
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  DHODH
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB, IHC-P
• Recommended dilutions
  Western blot: 0.5-1ug/ml,IHC (FFPE): 1-2ug/ml
• Added buffer
  Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2.5% BSA and 0.025% sodium azide
• Intented use
  This DHODH antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  Q02127
• Purity
  Antigen affinity
• Description
  Dihydroorotate dehydrogenase is an enzyme that in humans is encoded by the DHODH gene on chromosome 16. The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.
• Immunogen
  Amino acids 132-173 (RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTED) from the human protein were used as the immunogen for the DHODH antibody.
• Storage
  After reconstitution, the DHODH antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Localization
  Cytoplasmic
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  DHODH  
• Gene symbol
  DHODH
• Short name
  Anti- DHODH
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to DHODH
• Alternative technique
  antibodies
• Alternative to gene target
  dihydroorotate dehydrogenase (quinone), DHOdehase and POADS and URA1, DHODH and IDBG-41409 and ENSG00000102967 and 1723, ubiquinone binding, Plasma membranes, Dhodh and IDBG-191275 and ENSMUSG00000031730 and 56749, DHODH and IDBG-634716 and ENSBTAG00000046908 and

Gene info

• Identity
  HGNC:2867
• Gene
  DHODH
• Long gene name
  dihydroorotate dehydrogenase (quinone)
• Synonyms gene name
  • dihydroorotate dehydrogenase
• Locus
  16q22.2
• Discovery year
  1993-06-29
• Entrez gene record
  1723
• Pubmed identfication
  • 8211381
• RefSeq identity
  • NM_001361
• VEGA ID
  OTTHUMG00000178093

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products