Rabbit DHODH antibody
-
Catalog number70R-1749
-
PricePlease ask
-
Size100 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaProteases, Inhibitors, & Enzymes
-
ImmunogenDHODH antibody was raised using the N terminal of DHODH corresponding to a region with amino acids FGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLR
-
SpecificityDHODH antibody was raised against the N terminal of DHODH
-
Cross ReactivityHuman,Mouse,Rat,Dog,ZebraFish
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of DHODH antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolDHODH
-
Short nameRabbit DHODH antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal DHODH antibody raised against the N terminal of DHODH
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetdihydroorotate dehydrogenase (quinone), DHOdehase and POADS and URA1, DHODH and IDBG-41409 and ENSG00000102967 and 1723, ubiquinone binding, Plasma membranes, Dhodh and IDBG-191275 and ENSMUSG00000031730 and 56749, DHODH and IDBG-634716 and ENSBTAG00000046908 and
-
Gene info
-
Identity
-
Gene
-
Long gene namedihydroorotate dehydrogenase (quinone)
-
Synonyms gene name
- dihydroorotate dehydrogenase
-
Locus
-
Discovery year1993-06-29
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data