SLC4A1 Blocking Peptide

  • Catalog number
    33R-7368
  • Price
    Please ask
  • Size
    100 ug
  • Product Type
    Proteins
  • Product Subtype
    Blocking Peptides
  • Research Area
    Cell Biology
  • Tag Conjugate
    PSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGR
  • Type1
    Synthetic
  • Form Buffer
    Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
  • Storage
    Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
  • Applications
    WB, IHC
  • Shipping Info
    Blue Ice
  • Test
    You can block the antibody by the specific target amino acid sequence of peptide.
  • Properties
    blocking peptide
  • Description
    Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
  • Gene target
    SLC4A1  
  • Gene symbol
    SLC4A1
  • Short name
    SLC4A1 Blocking Peptide
  • Technique
    blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
  • Alternative name
    solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Die this GO blood family) inhibiting short protein sequence
  • Alternative technique
    control, peptides
  • Alternative to gene target
    solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Die this GO blood group), AE1 and BND3 and CD233 and DI and EMPB3 and EPB3 and FR and RTA1A and SW and WD and WD1 and WR, SLC4A1 and IDBG-53601 and ENSG00000004939 and 6521, protein anchor, Plasma membranes, Slc4a1 and IDBG-212590 and ENSMUSG00000006574 and 20533, BB3 and IDBG-640933 and ENSBTAG00000001610 and 286817
Gene info
Similar products
Filters
Contact
Chat with gentaur.com employee