SLC4A1 antibody

• Catalog number
  70R-2370
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Cell Biology
• Type of Immunogen
  SLC4A1 antibodies were raised using a synthetic peptide corresponding to a region with amino acids PSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGR
• Raised in
  Rabbit
• Cross Reactivity
  Human
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC4A1 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 0.1 ug/ml
• Assay Information
  SLC4A1 Blocking Peptide, catalog no. 33R-7368, is also available for use as a blocking control in assays to test for specificity of this SLC4A1 antibody
• Additional Information
  This is a rabbit polyclonal antibody against SLC4A1, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  SLC4A1  
• Gene symbol
  SLC4A1
• Short name
  SLC4A1 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal SLC4A1 antibody
• Alternative technique
  antibodies
• Alternative to gene target
  solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Die this GO blood group), AE1 and BND3 and CD233 and DI and EMPB3 and EPB3 and FR and RTA1A and SW and WD and WD1 and WR, SLC4A1 and IDBG-53601 and ENSG00000004939 and 6521, protein anchor, Plasma membranes, Slc4a1 and IDBG-212590 and ENSMUSG00000006574 and 20533, BB3 and IDBG-640933 and ENSBTAG00000001610 and 286817

Gene info

• Identity
  HGNC:11027
• Gene
  SLC4A1
• Long gene name
  solute carrier family 4 member 1 (Diego blood group)
• Synonyms gene
  • EPB3
  • AE1
  • DI
  • WD
• Synonyms gene name
  • Waldner blood group
  • erythrocyte membrane protein band 3
  • Diego blood group
  • solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Diego blood group)
  • solute carrier family 4 (anion exchanger), member 1
  • solute carrier family 4 (anion exchanger), member 1 (Diego blood group)
• Synonyms
  • RTA1A
  • CD233
  • FR
  • SW
  • WR
• Synonyms name
  • Froese blood group
  • Swann blood group
  • Wright blood group
• Locus
  17q21.31
• Discovery year
  1988-04-20
• Entrez gene record
  6521
• Pubmed identfication
  • 8434259
• RefSeq identity
  • NM_000342
• Classification
  • Blood group antigens
  • Solute carriers
  • CD molecules
• VEGA ID
  OTTHUMG00000156843
• Locus Specific Databases
  • Blood Group Antigen Mutation Database
  • LRG_803

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products