Recombinant Cynomolgus Tumor Necrosis Factor Ligand 2B/OX40L(N-8His)

• Catalog number
  CP72-10
• Price
  Please ask
• Size
  10 ug

• Description
  Recombinant Cynomolgus monkey OX40 Ligand is produced by our Mammalian expression system and the target gene encoding Gln51-Leu183 is expressed with a 8His tag at the N-terminus.
• Species reactivity
  Cynomolgus monkey
• Origin
  Human cells
• Peptide sequence
  HHHHHHHHQVSHQYPRIQSIKVQFTEYKKEEGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
• Estimated molecular weight
  16,5 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  F7FL80
• Other related products
• Additional description
  Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells. FAS ligand and other ligands are binding to the receptor for signaling pathways for example in apoptosis or JNK signaling. Receptor agonists are often tested for drug development.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Cynomolgus   Tumor   Necrosis   Factor   Ligand   2B/OX40L   N-8His  
• Short name
  Recombinant Cynomolgus Tumor Necrosis Factor Ligand 2B/OX40L(N-8His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Alternative name
  Recombinant Cynomolgus OX40L(N-8His)
• Alternative technique
  rec
• Tissue
  tumor

MeSH Data

• Name
  Tumor Stem Cell Assay
• Concept
  Scope note: A cytologic technique for measuring the functional capacity of tumor stem cells by assaying their activity. It is used primarily for the in vitro testing of antineoplastic agents.
• Tree numbers
  • E01.370.225.500.383.910
  • E01.370.225.500.388.930
  • E05.200.500.383.910
  • E05.200.500.388.930
  • E05.242.383.910
  • E05.242.417.500
  • E05.337.550.200.800
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products